PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_15628_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 61aa    MW: 6821.02 Da    PI: 11.0122
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_15628_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.81.6e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +i+n++ rqvtfskRr+g++KKA+ELS+LCdaev ++ifsstgklye+ss
  Neem_15628_f_3 10 KIDNSTSRQVTFSKRRKGLIKKAKELSILCDAEVGLVIFSSTGKLYEFSS 59
                    79**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-29260IPR002100Transcription factor, MADS-box
CDDcd002655.97E-35260No hitNo description
PRINTSPR004046.9E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MGRGKIVIQK IDNSTSRQVT FSKRRKGLIK KAKELSILCD AEVGLVIFSS TGKLYEFSST  60
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-19160160Myocyte-specific enhancer factor 2B
1tqe_Q7e-19160160Myocyte-specific enhancer factor 2B
1tqe_R7e-19160160Myocyte-specific enhancer factor 2B
1tqe_S7e-19160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466574.11e-33PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6Z6W27e-34MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A067GTF27e-34A0A067GTF2_CITSI; Uncharacterized protein
TrEMBLA0A0D3A1502e-33A0A0D3A150_BRAOL; Uncharacterized protein
STRINGSi019880m1e-32(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.19e-33AGAMOUS-like 44